Share this post on:

Name :
LGALS13 (Human) Recombinant Protein

Biological Activity :
Human LGALS13 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :

Protein Accession No. :
Q8TCE9

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=56891

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD

Molecular Weight :
18.5

Storage and Stability :
Store at 4°C for 2-4 weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
chromatographic

Quality Control Testing :

Storage Buffer :
Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 20% glycerol, 0.1 M NaCl, 1 mM DTT.

Applications :
SDS-PAGE,

Gene Name :
LGALS14

Gene Alias :
CLC2, MGC22235, PPL13

Gene Description :
lectin, galactoside-binding, soluble, 14

Gene Summary :
This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Other Designations :
Charcot-Leyden crystal protein 2|placental protein 13-like protein

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-9 Proteinsite
Macrosialin/CD68 ProteinFormulation
Popular categories:
CD1b
Serpin A3C

Share this post on:

Author: GTPase atpase