Name :
eco (Escherichia coli) Recombinant protein
Biological Activity :
Escherichia coli eco (NP_416713, 21 a.a. – 162 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
NP_416713
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=946700
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Molecular Weight :
18.3
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
In 20 mM Tris-HCl buffer, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Applications :
SDS-PAGE，
Gene Name :
eco
Gene Alias :
ECK2201, JW2197, eti
Gene Description :
ecotin, a serine protease inhibitor
Gene Summary :
–
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MIG/CXCL9 ProteinStorage & Stability
CC Chemokines Recombinant Proteins
Popular categories:
Histidine-Proline-rich Glycoprotein (HPRG)
IFN-alpha 2a
