Name :
IGF2 (Human) Recombinant Protein
Biological Activity :
Human IGF2 (P01344) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
P01344
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3481
Amino Acid Sequence :
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Weight :
7.5
Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions
Storage Buffer :
No additive
Applications :
Functional Study， SDS-PAGE，
Gene Name :
IGF2
Gene Alias :
C11orf43, FLJ22066, FLJ44734, INSIGF, pp9974
Gene Description :
insulin-like growth factor 2 (somatomedin A)
Gene Summary :
This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3′ region and to the upstream INS gene at the 5′ region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
Other Designations :
OTTHUMP00000011012|OTTHUMP00000011015|OTTHUMP00000011018|OTTHUMP00000011157|insulin-like growth factor 2|insulin-like growth factor II|insulin-like growth factor type 2|putative insulin-like growth factor II associated protein|somatomedin A
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Bone Morphogenetic Proteins (BMPs) Recombinant Proteins
Integrin Associated Protein/CD47 web
Popular categories:
Dectin-1
XC Chemokine Receptor 1
