Share this post on:

Name :
ARTN (Human) Recombinant Protein

Biological Activity :
Human ARTN (Q5T4W7) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
Q5T4W7

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=9048

Amino Acid Sequence :
AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

Molecular Weight :
24.2

Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions

Storage Buffer :
Lyophilized from 10 mM sodium citrate, 25 mM NaCl, pH 4.5

Applications :
Functional Study, Functional Study, SDS-PAGE, SDS-PAGE,

Gene Name :
ARTN

Gene Alias :
ENOVIN, EVN, NBN

Gene Description :
Artemin

Gene Summary :
The protein encoded by this gene is a member of the glial cell line-derived neurotophic factor (GDNF) family of ligands which are a group of ligands within the TGF-beta superfamily of signaling molecules. GDNFs are unique in having neurotrophic properties and have potential use for gene therapy in neurodegenerative disease. Artemin has been shown in culture to support the survival of a number of peripheral neuron populations and at least one population of dopaminergic CNS neurons. Its role in the PNS and CNS is further substantiated by its expression pattern in the proximity of these neurons. This protein is a ligand for the RET receptor and uses GFR-alpha 3 as a coreceptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Other Designations :
OTTHUMP00000009173|OTTHUMP00000009174|neublastin|neurotrophic factor|neurotrophic factor Artemin

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD4 Recombinant Proteins
TNF Superfamily Ligands site
Popular categories:
Ebola Virus GP2
Neuronal Cell Adhesion Molecule

Share this post on:

Author: GTPase atpase