Name :
PHLDA2 (Human) Recombinant Protein
Biological Activity :
Human PHLDA2 (NP_003302, 1 a.a. – 152 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
NP_003302
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=7262
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Molecular Weight :
19.2
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer :
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 20% glycerol).
Applications :
SDS-PAGE,
Gene Name :
PHLDA2
Gene Alias :
BRW1C, BWR1C, HLDA2, IPL, TSSC3
Gene Description :
pleckstrin homology-like domain, family A, member 2
Gene Summary :
This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Studies of the mouse gene, however, which is also located in an imprinted gene domain, have shown that the product of this gene regulates placental growth. [provided by RefSeq
Other Designations :
imprinted in placenta and liver|p17-Beckwith-Wiedemann region 1C|pleckstrin homology-like domain family A member 2|tumor suppressing subchromosomal transferable fragment cDNA 3|tumor suppressing subtransferable candidate 3|tumor-supressing STF cDNA 3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-12 ProteinGene ID
CD51/Integrin alpha V Recombinant Proteins
Popular categories:
Gastric Inhibitory Peptide (GIP)
Complement Component 8 beta Chain
